Cagrilintide is a synthetic long-acting amylin analog targeting AMYR/CTR receptors. Lyophilized peptide for research use only.
Product Description
Cagrilintide is a synthetic long-acting amylin analogue designed for in vitro research applications. This modified protein targets both amylin and calcitonin receptors through its specialized amino acid sequence and N-terminal lipidation.
The peptide demonstrates improved stability compared to native amylin while maintaining receptor binding affinity. Supplied as research-grade lyophilized powder with pharmaceutical manufacturing standards.
Third-party tested for purity verification. Intended for qualified research institutions conducting receptor studies and peptide mechanism research. Research use only.
Peptide Specifications
| SPECIFICATION | DESCRIPTION |
|---|---|
| Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Molecular Formula | C194H312N54O59S2 |
| Molecular Weight | 4409.01 g/mol |
| CAS Number | 1415456-99-3 |
| PubChem SID | 171397054 |
| Synonyms | AM833, AT42613 |
| Purity | ≥98.5% (HPLC) |
| Solubility | Soluble in water and aqueous buffers |
| Storage Conditions | Store at -20°C, tightly sealed, away from heat and moisture |
| Physical Appearance | White lyophilized powder |
| Shelf Life | 36 months from date of manufacture when stored properly |
| Quality Verification | Third-party tested by certified laboratory |
| Manufacturing Standard | USA-made, pharmaceutical-grade, GMP compliant |
| Intended Application | In vitro research applications only |
Our Product Quality Guarantee
Every Limitless Biotech Premium Lyophilized compound undergoes comprehensive independent third-party testing, including HPLC purity, sterility, endotoxin, and identity verification, as part of our systematic quality protocols.
Buy Cagrilintide From Limitless Biotech
Limitless Biotech provides USA-manufactured Cagrilintide for sale with verified molecular sequences and purity through comprehensive third-party testing. We ensure research quality with same-day shipping and dedicated customer support for your scientific endeavors.
- Container:
- Glass Vial
- Presentation:
- Solid Crystals
At Limitless Biotech, we provide comprehensive Certificates of Analysis (COAs) for all of our research-only peptides to ensure transparency, purity, and quality in every batch. Each COA includes detailed analytical data that allows researchers to verify identity, concentration, and integrity, supporting reliable and reproducible scientific work. Our commitment to rigorous testing helps researchers move forward with confidence in the materials they use.
Lyophilized Cagrilinitide #1196 Sterility COA
Lyophilized Cagrilinitide #1196 Endotoxin COA
Lyophilized Cagrilinitide #1196 Purity COA
Lyophilized Cagrilinitide #1349 Sterility COA
